accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,690,439)
Primary Antibody Matched Pairs (7,033)
Protein Interaction Antibody Pairs (1,443)
Protein Phosphorylation Antibody Pairs (74)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (4)
  • (191,788)

brands

  • (1)
  • (1)
  • (29)
  • (2)
  • (2)
  • (973)
  • (67,056)
  • (14,167)
  • (44)
  • (6)
  • (59,913)
  • (1)
  • (110)
  • (266)
  • (2)
  • (1,312)
  • (578)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,632)
  • (398)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (60)
  • (1)
  • (6)
  • (1)
  • (64)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (77)
  • (5)
  • (18)
  • (20)
  • (1)
  • (14,089)
  • (2)
  • (1)
  • (1)
  • (31,127)
  • (84)
  • (470)
  • (2)
  • (1)
  • (11,571)
  • (1)
  • (1)
  • (53)
  • (3,054)
  • (6)
  • (470)
  • (105)
  • (22,742)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,773)
  • (1)
  • (76)
  • (18,951)
  • (139)
  • (203)
  • (3)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,814)
  • (30)
  • (1)
  • (2)
  • (45)
  • (43)
  • (14,698)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (41)
  • (2)
  • (1)
  • (62)
  • (53)
  • (487)
  • (56)
  • (10)
  • (3)
  • (80)
  • (12)
  • (11)
  • (1,198)
  • (8)
  • (9)
  • (2)
  • (20)
  • (11)
  • (1)
  • (25)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (212)
  • (4)
  • (127)
  • (2)
  • (1)
  • (694)
  • (13)
  • (915)
  • (1)
  • (120)
  • (2,105)
  • (116)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (978)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (302)
  • (1)
  • (1,822)
  • (2)
  • (1)
  • (2)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (17)
  • (1)
  • (24)
  • (11)
  • (13)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (154,130)
  • (5)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (11)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (198)
  • (1,162)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (38)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,119)
  • (680)
  • (167)
  • (1)
  • (6)
  • (1)
  • (8,397)
  • (1)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (116)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1,016,809)
  • (1)
  • (13)
  • (1)
  • (2)
  • (30,487)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (1,784)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (23)
  • (35,349)
  • (1)
  • (9)
  • (12,199)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (41)
  • (7)
  • (57)
  • (15)
  • (60,271)
  • (1)
  • (5)
  • (17)
  • (4)
  • (1)
  • (30)
  • (549)
  • (1)
  • (12)
  • (2,474)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (438)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,453)
  • (136)
  • (1)
  • (1)
  • (1)
  • (557)
  • (19,477)
  • (1)
  • (6)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (3)
  • (826)
  • (2)
  • (1)
  • (3)
  • (1)
  • (10)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (56)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (16)
  • (1)
  • (2)
  • (28)
  • (262)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (15,250)
  • (166,521)
  • (27)
  • (1,150,734)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (922)
  • (1,918)
  • (4,393)
Show all

Classification

  • (81)
  • (105)
  • (724,906)
  • (3,641)
  • (5)
  • (684,989)
  • (31,441)
Show all

Host Species

  • (564)
  • (2,639)
  • (38)
  • (1)
  • (15)
  • (1,629)
  • (726)
Show all

Conjugate

  • (29,700)
  • (9)
  • (1)
  • (25)
  • (2,863)
  • (74)
  • (89)
Show all

Applications

  • (2)
  • (36)
  • (23)
  • (169)
  • (830)
  • (3)
  • (4)
Show all

Target Species

  • (55)
  • (34)
  • (88)
  • (135)
  • (5)
  • (665)
  • (125)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (335)
  • (962)
  • (1,358,650)

Form

  • (2,701)
  • (2,147)
  • (1,630)
  • (14)
  • (9)
  • (20)
  • (298,260)
Show all

Research Discipline

  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
646 – 660 of 1,620,197 results
646

Invitrogen™ ITGA9 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. Q13797
Isotype IgG
Concentration 1 mg/mL
Antigen ITGA9
Gene Symbols Itga9
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias (alpha)9; 2610002H11Rik; 6720458D17Rik; AI461869; ALPHA-RLC; D130073C02; D9Ertd428e; integrin alpha 9; integrin alpha-9; Integrin alpha-RLC; integrin subunit alpha 9; integrin, alpha 9; ITGA4L; Itga9; Itga9l; RLC
Gene Itga9
Product Type Antibody
Gene ID (Entrez) 3680
Formulation PBS with 1% BSA, 20% glycerol and 0.01% thimerosal; pH 7
Immunogen Recombinant protein encompassing a sequence within the Extracellular domain of human Integrin alpha 9. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
647

Invitrogen™ CD278 (ICOS) Monoclonal Antibody (ISA-3), Super Bright™ 780, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Super Bright 780
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9Y6W8
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD278 (ICOS)
Gene Symbols ICOS
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Activation-inducible lymphocyte immunomediatory molecule; Ailim; CCLP; CD278; CD28 and CTLA-4-like protein; CD28-related protein 1; CRP-1; CVID1; H4; Icos; inducible costimulator; inducible T cell costimulator; inducible T cell co-stimulator; inducible T-cell costimulator; inducible T-cell co-stimulator; Ly115
Gene ICOS
Product Type Antibody
Gene ID (Entrez) 29851
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone ISA-3
648

Invitrogen™ Neurocan Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. O14594, P55066, P55067
Isotype IgG
Concentration 500 μg/mL
Antigen Neurocan
Gene Symbols Ncan
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 245 kDa early postnatal core glycoprotein; C230035B04; Chondroitin sulfate proteoglycan 3; chondroitin sulfate proteoglycan 3 (neurocan); chondroitin sulfate proteoglycan 3, related sequence; Cspg3; Cspg3-rs; NCAN; NEUR; neurocan; neurocan core protein; neurocan proteoglycan; TGFbeta-induced transcript, brain; Tgfbit
Gene Ncan
Product Type Antibody
Gene ID (Entrez) 13004, 1463, 58982
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human Neurocan (HENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFA).
Classification Polyclonal
Primary or Secondary Primary
649

Invitrogen™ MHC Class II Monoclonal Antibody (OX17), PerCP-eFluor™ 710, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Rat
Host Species Mouse
Conjugate PerCP-eFluor 710
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen MHC Class II
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias beta 1 domain; B-L; B-L beta chain; B-L beta minor; B-LB; BLB major; BLB1; BLB2; B-LB2; B-LB21; B-LB21 major; BLB3; Bl-Beta II protein; B-LBII; class II histocompatibility antigen, B-L beta chain; class II histocompatibility antigen, M alpha chain; D6S222E; DMA; FECA-DRB; GSP-BLB1; GSP-BLB2; HLA class II histocompatibility antigen, DM alpha chain; HLADM; HLA-DMA; major histocompatibility class II antigen B-L beta; major histocompatibility complex class II B; Major histocompatibility complex class II beta chain BLB1; Major histocompatibility complex class II beta chain BLB1, (similar to HLA class II, D beta chain); major histocompatibility complex class II beta chain BLB1, (similar to HLA class II, D beta chain); Major histocompatibility complex class II beta chain BLB2, (similar to HLA class II, D beta chain); Major histocompatibility complex class II beta chain BLB3, (similar to HLA class II, D beta chain); major histocompatibility complex, class II, DM alpha; MHC 2; MHC Class II; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen B-F minor heavy chain; MHC class II antigen DMA; MHC class II antigen DRB; MHC Class II beta 1 and 2 domains; MHC class II beta 1 domain; MHC class II beta chain; MHC class II beta chain 1; MHC class II beta chain 2; MHC class II B-L beta chain; MHC II; MHCCII; MHCFECA-DRB; really interesting new gene 6 protein; RING6; S19; uncharacterized protein LOC101747454
Product Type Antibody
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone OX17
650

Invitrogen™ OCT3/4 Recombinant Rat Monoclonal Antibody (EM92), Alexa Fluor™ Plus 555

Rat Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Rat
Conjugate Alexa Fluor Plus 555
Applications Flow Cytometry,Immunocytochemistry
Form Liquid
Gene Accession No. Q01860
Isotype IgG2a κ
Concentration 1.0 mg/mL
Antigen OCT3/4
Gene Symbols POU5F1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 2-Oct; 3-Oct; 4-Oct; cb197; chunp6868; DADB-104B20.2; etID49452.21; gp9; gp-9; HGNC:9221; homeobox protein; lymphoid-restricted immunoglobulin octamer-binding protein NF-A2; MGC22487; NF-A3; Oct2; Oct-2; Oct2a; Oct2b; OCT3; Oct-3; Oct3/4; Oct-3/4; OCT4; Oct-4; Octamer-binding protein 2; octamer-binding protein 3; Octamer-binding protein 4; octamer-binding transcription factor 2; Octamer-binding transcription factor 3; OTF2; OTF-2; OTF3; Otf-3; Otf3g; Otf3-rs7; Otf4; Otf-4; OTTHUMP00000221150; OTTHUMP00000221151; POU class 2 homeobox 2; POU class 5 homeobox 1; POU class 5 homeobox 1 transcript variant OCT4B1; POU class 5 homeobox 1 transcript variant OCT4B2; POU class 5 homeobox 1 transcript variant OCT4B3; POU class 5 homeobox 1 transcript variant OCT4B4; POU class 5 homeobox 1 transcript variant OCT4B5; POU class 5 homeobox 1 transcript variant OCT4B6; POU domain class 5 transcription factor 1; POU domain gene 2; POU domain protein 2; POU domain transcription factor OCT4; POU domain, class 2, transcription factor 2; POU domain, class 5, transcription factor 1; POU domain, class 5, transcription factor 3; pou2; pou-2; POU2F2; Pou5f1; pou5f1 protein; pou5f3; POU-type homeodomain-containing DNA-binding protein; spg; spg/pou2; spiel-ohne-grenzen; spiel-ohne-grenzen/pou2; wu:fd18d06
Gene POU5F1
Product Type Antibody
Gene ID (Entrez) 5460
Formulation Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone EM92
651

Invitrogen™ CD15 Monoclonal Antibody (HI98), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P22083
Isotype IgM κ
Concentration 5 μL/Test
Antigen CD15
Gene Symbols FUT4
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias FUTIV; Lewis X; SSEA-1
Gene FUT4
Product Type Antibody
Gene ID (Entrez) 2526
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone HI98
652

Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), Alexa Fluor™ 561, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Alexa Fluor 561
Applications Flow Cytometry
Form Liquid
Isotype IgG2b κ
Gene Accession No. P0CW02, P0CW03, P35461
Concentration 0.2 mg/mL
Antigen Ly-6G/Ly-6C
Gene Symbols Ly6c1, Ly6c2, Ly6g
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AA682074; AA959465; Gr1; Gr-1; Granulocyte Marker; Ly6c; Ly-6C; Ly-6C.2; Ly6c1; Ly-6C1; Ly6c2; Ly-6C2; Ly6g; Ly-6G; ly-6G.1; lymphocyte antigen 6 complex, locus C; lymphocyte antigen 6 complex, locus C1; lymphocyte antigen 6 complex, locus C2; lymphocyte antigen 6 complex, locus G; lymphocyte antigen 6C precursor (Ly-6C); lymphocyte antigen 6C1; Lymphocyte antigen 6C2; lymphocyte antigen 6G; Lymphocyte antigen Ly-6C; lymphocyte differentiation antigen; PML; PMN
Product Type Antibody
Gene ID (Entrez) 100041546, 17067, 546644
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone RB6-8C5
653

Invitrogen™ Mesothelin Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Lyophilized
Gene Accession No. Q13421
Isotype IgG
Concentration 500 μg/mL
Antigen Mesothelin
Gene Symbols MSLN
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias CAK1; CAK1 antigen; megakaryocyte potentiating factor; Megakaryocyte-potentiating factor; Mes; Mesothelin; Mesothelin, cleaved form; MPF; MSLN; Pre-pro-megakaryocyte-potentiating factor; SMR; SMRP; soluble MPF mesothelin related protein
Gene MSLN
Product Type Antibody
Gene ID (Entrez) 10232
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Immunogen E.coli-derived human Mesothelin recombinant protein (Position: K306-L576).
Classification Polyclonal
Primary or Secondary Primary
654

Invitrogen™ IRF8 Monoclonal Antibody (V3GYWCH), PE-Cyanine7, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Mouse
Host Species Mouse
Conjugate PE-Cyanine7
Applications Flow Cytometry
Form Liquid
Gene Accession No. P23611, Q02556
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen IRF8
Gene Symbols Irf8
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AI893568; H-ICSBP; Icsbp; Icsbp1; IMD32A; IMD32B; interferon consensus sequence binding protein 1; Interferon consensus sequence-binding protein; Interferon regulatory factor 8; Irf8; IRF-8; Myls; transcription factor ICSBP
Gene Irf8
Product Type Antibody
Gene ID (Entrez) 15900, 3394
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone V3GYWCH
655

Invitrogen™ H3K36ac Recombinant Rabbit Monoclonal Antibody (RM154), ChIP-Verified
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Peptide Array,ChIP Assay,ELISA,Western Blot,Luminex,Immunocytochemistry
Form Liquid
Gene Accession No. P68431, Q71DI3
Isotype IgG
Concentration 1 mg/mL
Antigen H3K36ac
Gene Symbols H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7
Regulatory Status RUO
Purification Method Protein A
Gene Alias 9430068D06Rik; Acetyl H3; Acetyl Histone H3; Acetyl-H3 K36; Acetyl-H3 Lys36; Acetyl-Histone H3 K36; Acetyl-Histone H3 Lys36; B0035.7; CELE_T10C6.12; CG31613; CG31613-PA; CG33803; CG33806; CG33809; CG33812; CG33815; CG33818; CG33821; CG33824; CG33827; CG33830; CG33833; CG33836; CG33839; CG33842; CG33845; CG33848; CG33851; CG33854; CG33857; CG33860; CG33863; CG33866; Dmel\CG31613; Dmel_CG31613; F07B7.10; F07B7.3; F08G2.2; F17E9.13; F35H10.1; F45F2.4; F54E12.5; F55G1.10; H02I12.7; H3; H3 histone; H3 histone family, member A; H3 histone family, member C; H3 histone family, member H; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3C; H3 K36ac; H3.1; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; h3.2a; H3.3A; H3.3B; H3.5; H3/A; H3/b; H3/c; H3/d; H3/f; H3/h; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3a; H3-3b; H3-53; H3-614; H3a; H3b; H3-B; H3c1; H3c10; H3c11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3c8; H3f; H3-F; H3F1K; H3F2; H3F3; H3f3a; H3f3b; H3F3C; H3FA; H3FB; H3FC; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3K36; H3L-like histone; H3Lys36ac; h3r; his-12; his-16; his-19; his-21; His3; his-3; His3:CG31613; His3:CG31613-PA; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; his-30; his-33; his-43; his-47; his-51; his-53; his-57; his-61; his-65; his-68; his-7; Hist1; Hist1h3a; HIST1H3B; Hist1h3c; HIST1H3D; HIST1H3E; HIST1H3F; Hist1h3g; hist1h3g.L; HIST1H3H; HIST1H3I; HIST1H3J; hist2h3; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone 1, H3a; histone 1, H3b; histone 1, H3c; histone 1, H3f; histone 1, H3g; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3c; histone cluster 1, H3f; histone cluster 1, H3g; histone cluster 1, H3g protein L homeolog; histone cluster 1, H3h; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone gene complex 1; Histone H2A; Histone H3; histone H3.1; Histone H3.2; histone H3.3; histone H3.3B-like; histone H3.3C; Histone H3.5; histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; Histone H3K36; histone variant H3.5; histone1, H3c; K06C4.11; K06C4.3; M32460; M32461; PP781; T10C6.12; T23D8.6; XELAEV_18028537mg; ZK131.10; ZK131.6
Gene H3C15
Product Type Antibody
Gene ID (Entrez) 126961, 333932, 8350, 8356, 8357, 8358, 8968
Formulation PBS with 50% glycerol, 1% BSA and 0.09% sodium azide; pH 7.2-7.4
Immunogen Acetyl-peptide corresponding to the Acetyl-Histone H3 (Lys36).
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone RM154
656

Invitrogen™ ACACB Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. E9Q4Z2, O00763
Isotype IgG
Concentration 500 μg/mL
Antigen ACACB
Gene Symbols ACACB
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Acacb; Acc2; ACCB; ACC-beta; acetyl-CoA carboxylase 2; acetyl-CoA carboxylase beta; acetyl-Coenzyme A carboxylase 2; acetyl-Coenzyme A carboxylase beta; AI597064; AW743042; Biotin carboxylase; HACC275
Gene ACACB
Product Type Antibody
Gene ID (Entrez) 100705, 116719, 32
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Classification Polyclonal
Primary or Secondary Primary
657

CD144 (VE-cadherin) Monoclonal Antibody (eBioBV14 (BV14)), eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Mouse
Host Species Rat
Conjugate Unconjugated
Applications Functional Assay,Immunohistochemistry (Frozen),Immunoprecipitation,Western Blot
Form Liquid
Isotype IgG2b
Gene Accession No. P55284
Concentration 0.5 mg/mL
Antigen CD144 (VE-cadherin)
Gene Symbols CDH5
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 7B4; 7B4 antigen; 7B4/cadherin-5; AA408225; cadherin 5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE-cadherin (vascular endothelium); cadherin 5, type 2, VE-cadherin (vascular epithelium); cadherin-5; cadherin-5; cd144 antigen; VE cadherin; Cd144; cd144 antigen; CDH5; cell-cell adhesion protein; endothelial-specific cadherin; vascular endothelial cadherin; vascular endothelial cadherin precursor; Vec; VEcad; VE-Cad; VE-cadherin; VECD
Gene CDH5
Product Type Antibody
Gene ID (Entrez) 12562
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioBV14 (BV14)
658

Invitrogen™ TGF beta-2 Monoclonal Antibody (220ct16.4.3.1)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P61812
Isotype IgG1 κ
Concentration 0.43 mg/mL
Antigen TGF beta-2
Gene Symbols TGFB2
Regulatory Status RUO
Purification Method Protein G
Gene Alias BB105277; BSC-1 cell growth inhibitor; cetermin; glioblastoma-derived T-cell suppressor factor; G-TSF; LAP; Latency-associated peptide; LDS4; polyergin; prepro-transforming growth factor beta-2; TGF beta 2 protein; TGFB; TGFB2; TGF-B2; Tgfb-2; TGF-beta2; TGF-beta-2; TGFβ2; Transforming growth factor; transforming growth factor beta 2; transforming growth factor beta-2; Transforming growth factor beta-2 proprotein; transforming growth factor, beta 2
Gene TGFB2
Product Type Antibody
Gene ID (Entrez) 7042
Formulation PBS with 0.09% sodium azide; pH 7.4
Immunogen TGFB2 recombinant protein.
Classification Monoclonal
Primary or Secondary Primary
Clone 220ct16.4.3.1
659

Invitrogen™ Bcl-xS Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Gene Accession No. P53563, Q07817, Q64373
Isotype IgG
Concentration 1 mg/mL
Antigen Bcl-xS
Gene Symbols Bcl2l1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias anti-apoptosis regulatory protein; apoptosis regulator Bcl-X; B cell lymphoma 2 like; B cell lymphoma like X; B-cell leukemia/lymphoma x; Bcl(X)L; BCL2 like 1; BCL2L; BCL2L1; bcl2-L-1; BCL2-like 1; Bcl-2-like protein 1; BCLX; bcl-x; BCLXL; Bcl-xl; BCL-XL/S; BCLXS; bcl-xS; Blc2l; PPP1R52; protein phosphatase 1, regulatory subunit 52
Gene Bcl2l1
Product Type Antibody
Gene ID (Entrez) 12048, 24888, 598
Formulation 0.1M tris glycine with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen Carrier-protein conjugated synthetic peptide encompassing a sequence within the C-terminus region of human Bcl-XS. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
660

Invitrogen™ MR1 Monoclonal Antibody (6A5B2)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q95460
Isotype IgG2a
Concentration 1 mg/mL
Antigen MR1
Gene Symbols MR1
Regulatory Status RUO
Purification Method Protein G
Gene Alias Class I histocompatibility antigen-like protein; H2ls; histocompatibility-2 complex class 1-like sequence; Hlals; Major histocompatibility complex class I-related gene protein; major histocompatibility complex, class I-like sequence; major histocompatibility complex, class I-related; MCH class I; MHC class I-like antigen MR-1; MHC class I-like sequence; MHC class I-related gene protein; MHC class-I related-gene protein; MR1; Mr1a
Gene MR1
Product Type Antibody
Gene ID (Entrez) 3140
Formulation PBS with 0.05% sodium azide
Immunogen Purified recombinant fragment of human MR1 (AA: extra(23-302)) expressed in E. Coli.
Classification Monoclonal
Primary or Secondary Primary
Clone 6A5B2